20 Best Arizona Cannabis Blogs and Websites

Follow Top 20 Arizona Cannabis Blogs from one place on Feedspot Reader
The best Arizona Cannabis blogs from thousands of blogs on the web and ranked by relevancy, authority, social media followers & freshness.

Arizona Cannabis Blogs

Here are 20 Best Arizona Cannabis Blogs you should follow in 2024

1. AllBud

AllBud AllBud serves as the go-to resource for medical and recreational cannabis enthusiasts. Offering insights into dispensaries, strains, and doctors, it keeps users updated on the latest cannabis seeds news and culture. Explore articles covering medical weed, dispensaries, and related topics for comprehensive cannabis knowledge and resources.
allbud.com
Twitter Followers 7.5K Frequency 1 post / week Domain Authority 46 Get Email Contact

2. AZ Marijuana

AZ Marijuana Explore AZmarijuana.com for Arizona's latest cannabis news, deals, and resources. Discover adult-use dispensaries, doctors, laws, and events. Their comprehensive guide covers medical and recreational marijuana, including laws, qualifying conditions, obtaining a medical card, strain selection, and purchasing from dispensaries. Gain valuable insights into Arizona's cannabis landscape and beyond.
azmarijuana.com
Facebook Followers 22.3KTwitter Followers 2K Frequency 2 posts / week Domain Authority 48 Get Email Contact

3. Kind Meds Blog

Kind Meds Blog Kind Meds, a licensed dispensary, shares its passion for cannabis through top-shelf products and a commitment to quality. Offering both medical and recreational options, they prioritize an elevated experience. Their blog covers legal facts, recipes, medical uses, and product trends, providing comprehensive marijuana resources.
kindmedsaz.com
Facebook Followers 683Twitter Followers 468 Frequency 2 posts / month Domain Authority 26 Get Email Contact

4. My MMJ Doctor Blog

My MMJ Doctor Blog My MMJ Doctor facilitates easy access to cannabis education and medical evaluations online. With a mission to promote its medicinal benefits, they connect patients with qualified doctors for treatment recommendations. Their blog offers the latest marijuana insights, tips, and recipes, serving as a valuable resource for the cannabis community.
mymmjdoctor.com
Facebook Followers 627 Frequency 4 posts / week Get Email Contact

5. AZ Cannabis News

AZ Cannabis News AZ Cannabis News stands as the premier source for cannabis updates, hemp news, and legalization developments in Arizona. With a vast network of subscribers, including patients, advocates, and industry experts, their monthly newsletter delivers essential insights directly to inboxes, solidifying their reputation as the trusted online resource for all things cannabis in the state.
azcannabisnews.com
Facebook Followers 2.3K Frequency 1 post / week Get Email Contact

6. MJBiz » Arizona

MJBiz » Arizona MJBiz, a pioneer since 2011, offers cannabis business insights. Stay informed on Arizona's cannabis industry and legislative changes with Marijuana Business Daily, a premier publication in the field.
mjbizdaily.com
Facebook Followers 32KTwitter Followers 77.3KInstagram Followers 67.1K Frequency 1 post / week Domain Authority 65 Get Email Contact

7. Marijuana Doctor Blog

Marijuana Doctor Blog The Marijuana Doctor in Tempe, AZ, offers competitive prices on medical marijuana cards. Committed to education and accessibility, their physicians prioritize personalized care. Whether for pain or insomnia, they tailor treatments to individual needs. With a focus on patient education, they guide individuals through the process of obtaining a medical card, empowering informed decisions about medical marijuana use.
azmmjdr.com
Frequency 4 posts / quarter Get Email Contact

8. Mint Cannabis Blog

Mint Cannabis Blog Explore the Mint Deals Blog for the latest in cannabis news, covering both medical and recreational aspects. Their mission is to offer top-notch care to every patient through alternative treatments, education, support, and research, aiming to inspire hope and contribute to overall health and wellness.
mintdeals.com
Facebook Followers 3.9K Frequency 5 posts / month Get Email Contact

9. Treed Blog

Treed Blog Established in 2020, Treed is a lifestyle brand catering to active cannabis enthusiasts. Offering premium tools, accessories, clothing, and content, they elevate smoking experiences on the go. With a commitment to quality, Treed's curated collection stands above the rest, allowing consumers to elevate their lifestyle with top-notch products.
shoptreed.us
Frequency 9 posts / quarter Get Email Contact

10. Greenpharms Cannabis Blog

Greenpharms Cannabis Blog GreenPharms, a family-owned enterprise in Arizona, cultivates, processes, and sells top-tier cannabis products. Catering to both medical and recreational needs, they offer a diverse range. Explore their Cannabis Blog for the latest insights and comprehensive information, delving deep into the world of cannabis.
greenpharms.com
Frequency 9 posts / quarter Get Email Contact

11. All Greens Dispensary Blog

All Greens Dispensary Blog At All Greens Dispensary, Arizona marijuana patients and customers find value in daily specials and trusted staff. With online pre-ordering and delivery options, they prioritize convenience and quality service, ensuring a personalized experience for all patrons.
allgreensaz.com
Facebook Followers 2.8K Frequency 4 posts / quarter Get Email Contact

12. Arizona Daily Star » Marijuana

Arizona Daily Star » Marijuana Explore the Arizona Daily Star blog for insights on the Tucson Marijuana Guide. Delve into articles, updates, and comprehensive coverage, offering valuable information and tips on navigating the cannabis landscape in Tucson.
tucson.com
Instagram Followers 42.9K Frequency 9 posts / quarter Domain Authority 81 Get Email Contact

13. Hana Dispensaries Blog

Hana Dispensaries Blog Hana Dispensaries, an Arizona pioneer, spreads its passion for cannabis statewide. Established in 2015, it's now a leading name with two locations and renowned brands serving medical and recreational consumers. Hana is the go-to Cannabis Dispensary for South Mountain and Phoenix, offering quality products and exceptional service.
hanadispensaries.com
Facebook Followers 266 Frequency 9 posts / quarter Domain Authority 21 Get Email Contact

14. Wickenburg Alternative Medicine Blog

Wickenburg Alternative Medicine Blog Wickenburg Alternative Medicine (WAM) stands as a trusted nonprofit medical marijuana dispensary in El Mirage, AZ. Offering premium cannabis selections without compromising quality or budget, WAM prioritizes patient satisfaction. With expert staff and a welcoming atmosphere, they ensure an exceptional experience for all. Explore their blog for insights and visit their local store for premium cannabis in Arizona.
wamdispensary.com
Facebook Followers 193 Frequency 7 posts / quarter Get Email Contact

15. Trap Culture Blog

Trap Culture Blog Trap Culture, Arizona's premier cannabis event organizer, merges community, culture, and cannabis into unforgettable experiences. With a focus on safety and inclusivity, they curate diverse gatherings showcasing local vendors, live music, and unique entertainment. Dive into their story, sparked by passion and vision, to discover how Trap Culture is shaping the future of the cannabis lifestyle scene.
trapcultureaz.com
Frequency 7 posts / quarter Domain Authority 13 Get Email Contact

16. Marijuana Industry Trade Association AZ Blog

Marijuana Industry Trade Association AZ Blog The Marijuana Industry Trade Association AZ is a dynamic network of professionals and businesses shaping the cannabis industry's growth. Their focus on education, transparency, and inclusivity drives thoughtful regulation advocacy nationwide. Since May 2016, they've hosted monthly networking events in Arizona, drawing over a thousand attendees, and fostering industry connections and collaboration.
mita-az.org/blog
Frequency 6 posts / quarter Get Email Contact

17. Giving Tree Dispensary Blog

Giving Tree Dispensary Blog Giving Tree Dispensary is an Arizona cannabis leader known for its seed-to-sale commitment. Their vertically-integrated model ensures precision quality control in Phoenix. With a promise of premium products, they consistently deliver excellence, earning trust within the community.
givingtreedispensary.com
Frequency 10 posts / year Get Email Contact

18. Errl Cup Blog

Errl Cup Blog Established in 2015, The Errl Cup prioritizes safe access to clean cannabis for patients in Arizona. It's renowned as the state's premier cannabis awards and festival. With a focus on patient appreciation and dispensary accountability, Errl Cup hosts biannual competition events and vibrant gatherings throughout the year, including music festivals and campouts.
theerrlcup.com
Facebook Followers 9.8K Frequency 1 post / quarter Get Email Contact

19. Arizona Cannabis Blog

Arizona Cannabis Blog ArizonaStateCannabis.org serves as a hub for industry insights, catering to growers, manufacturers, sellers, and consumers. Through data-driven research, they navigate cannabis legalization and regulatory landscapes in Arizona. Their goal is to demystify the state's cannabis industry, offering clarity on its impact and evolution.
arizonastatecannabis.org
Get Email Contact

20. Marijuana Evaluations Blog

Marijuana Evaluations Blog Marijuana Evaluations offers confidential evaluations and MMJ card renewals across Arizona, including Phoenix. Their medical professionals assist in obtaining medical marijuana cards. Explore their resources on medical cannabis, including articles on CBD usage, chronic pain management, mental health, and more.
marijuanaevaluations.net
Facebook Followers 1.6K Frequency 4 posts / year Get Email Contact

Show 20 to 100

Arizona Cannabis Bloggers

Top Authors, Journalists, and Publishers covering Arizona Cannabis. Get Spreadsheet
Blogger NameEmailBlog LinkTotal Blog Posts
Dan Kingstonazmarijuana.com83
Matthew Revelesazmmjdr.com19
LisaMariemintdeals.com10
All Greens Dispensaryallgreensaz.com10
Garry Stewartmymmjdoctor.com9
Kate Robertsonmjbizdaily.com8
M. Revelestrapcultureaz.com7
phoenixnewtimesanalyticsgivingtreedispensary.com7
Kush Kroniclesazcannabisnews.com7
Chris Casacchiamjbizdaily.com7
Chris Weatherallkindmedsaz.com6
Omar Sacirbeymjbizdaily.com5
Blaketheerrlcup.com4
Solomon Israelmjbizdaily.com4
azcnazcannabisnews.com3
Steve Brandonmymmjdoctor.com3
Jay Neritheerrlcup.com3
Kate Lavinmjbizdaily.com2
Chris Robertsmjbizdaily.com1
Andrew Longmjbizdaily.com1
David Abbottazmarijuana.com1
Load 22 to 50 of 50 Bloggers